PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.4NG231400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family NF-YB
Protein Properties Length: 250aa    MW: 26821.2 Da    PI: 9.805
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.4NG231400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB148.91.1e-4642136296
                NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91 
                          r qdr++P+anvsrim+++lP +akis+ ake++q+cvsefisfvt+ea+++c+ e+rkt++++d++wa+  lGf+dy+ pl+++l++ r
  Pavir.4NG231400.1.p  42 RGQDRLMPVANVSRIMRHALPPHAKISDGAKEMIQDCVSEFISFVTGEANERCHTEHRKTVTAEDIVWAMNRLGFDDYIRPLNTFLQRMR 131
                          679*************************************************************************************** PP

                NF-YB  92 elege 96 
                          e+eg 
  Pavir.4NG231400.1.p 132 EIEGG 136
                          **985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.8E-4240138IPR009072Histone-fold
SuperFamilySSF471133.26E-3444139IPR009072Histone-fold
PfamPF008082.8E-2348111IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006156.9E-147593No hitNo description
PROSITE patternPS0068507894IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006156.9E-1494112No hitNo description
PRINTSPR006156.9E-14113131No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MSTDPQGPKP WAPCAMAPER AAVAKEAMST EPLVPGTEPV IRGQDRLMPV ANVSRIMRHA  60
LPPHAKISDG AKEMIQDCVS EFISFVTGEA NERCHTEHRK TVTAEDIVWA MNRLGFDDYI  120
RPLNTFLQRM REIEGGDGAG GSGSGRGSRR GSSLVALHGA QTMRPAYPDA PQGYAVRPVI  180
PRPVPVPASN AVASRFGSRY QLPGGQRSMA PYYGGAAFRA GGNRGGFYGD EASSSNEAPT  240
ARRARSRHY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B1e-3641132394NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A1e-3641132394NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0609744e-94BT060974.1 Zea mays full-length cDNA clone ZM_BFb0079C17 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004966908.11e-105PREDICTED: nuclear transcription factor Y subunit B-10-like
SwissprotQ84W661e-47NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLK3Y2D41e-111K3Y2D4_SETIT; Uncharacterized protein
STRINGSi008357m1e-110(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20138331
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.21e-46nuclear factor Y, subunit B6